Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : S2EWR2

dbSWEET id: dbswt_2083

Accession:   S2EWR2

Uniprot status:   Unreviewed

Organism:   Candidatus Nitrosoarchaeum

Kingdom:   Archaea

Taxonomy back to top


Archaea ⇒ Thaumarchaeota ⇒ Nitrosopumilales ⇒ Nitrosopumilaceae ⇒ Candidatus Nitrosoarchaeum.

Sequence Information back to top


Sequence length:   95

Substrate Binding Site:   SNSN           CVV:   338       CHI:   -8.6

Selectivity Filter:   GGGG           CVV:   192       CHI:   -1.6

Fasta sequence:

>tr|S2EWR2|S2EWR2_9ARCH|Unreviewed|Candidatus Nitrosoarchaeum|95
MEIDGTLLTILGIAAGVLILSGWVDQIIKGYKTKSLKDVSKYLMLFISGGSILWLIYGII
VSDVFIIGTNIAAIVLMMIVLFMKRRYEKSSKIHQ

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   9     Model end:   86

Inward Open:

Template:   4X5M.pdb

Model structure:  S2EWR2_inward.pdb    Alignment file: S2EWR2_inw.pir

Procheck score ⇒ Ramachandran plot: 91.8% favored    6.7% allowed    1.5% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  S2EWR2_outward.pdb    Alignment file: S2EWR2_out.pir

Procheck score ⇒ Ramachandran plot: 93.3% favored    6.0% allowed    .7% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  S2EWR2_occluded.pdb    Alignment file: S2EWR2_occ.pir

Procheck score ⇒ Ramachandran plot: 94.8% favored    5.2% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur