| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : S2EWR2
dbSWEET id: dbswt_2083
Accession: S2EWR2
Uniprot status: Unreviewed
Organism: Candidatus Nitrosoarchaeum
Kingdom: Archaea
Taxonomy back to top
Archaea ⇒ Thaumarchaeota ⇒ Nitrosopumilales ⇒ Nitrosopumilaceae ⇒ Candidatus Nitrosoarchaeum.
Sequence Information back to top
Sequence length: 95
Substrate Binding Site: SNSN CVV: 338 CHI: -8.6
Selectivity Filter: GGGG CVV: 192 CHI: -1.6
Fasta sequence:
>tr|S2EWR2|S2EWR2_9ARCH|Unreviewed|Candidatus Nitrosoarchaeum|95
MEIDGTLLTILGIAAGVLILSGWVDQIIKGYKTKSLKDVSKYLMLFISGGSILWLIYGII
VSDVFIIGTNIAAIVLMMIVLFMKRRYEKSSKIHQ
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 9 Model end: 86 Inward Open: Template: 4X5M.pdb Model structure: S2EWR2_inward.pdb Alignment file: S2EWR2_inw.pir Procheck score ⇒ Ramachandran plot: 91.8% favored 6.7% allowed 1.5% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: S2EWR2_outward.pdb Alignment file: S2EWR2_out.pir Procheck score ⇒ Ramachandran plot: 93.3% favored 6.0% allowed .7% week .0% disallowed Occluded: Model structure: S2EWR2_occluded.pdb Alignment file: S2EWR2_occ.pir Procheck score ⇒ Ramachandran plot: 94.8% favored 5.2% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA