Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : S0KJM1

dbSWEET id: dbswt_1903

Accession:   S0KJM1

Uniprot status:   Unreviewed

Organism:   Enterococcus avium

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Enterococcaceae ⇒ Enterococcus.

Sequence Information back to top


Sequence length:   88

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|S0KJM1|S0KJM1_ENTAV|Unreviewed|Enterococcus avium|88
MNKKDRTVLIFGRIASFLSVMMYVSYTPQIMNNLDGNKGNPIQPLVAMINCIFWVIYATM
QKKKDYPIIVANIPGIFLGAITFLTAII

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   12     Model end:   88

Inward Open:

Template:   4X5M.pdb

Model structure:  S0KJM1_inward.pdb    Alignment file: S0KJM1_inw.pir

Procheck score ⇒ Ramachandran plot: 87.7% favored    10.8% allowed    1.5% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  S0KJM1_outward.pdb    Alignment file: S0KJM1_out.pir

Procheck score ⇒ Ramachandran plot: 90.0% favored    7.7% allowed    2.3% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  S0KJM1_occluded.pdb    Alignment file: S0KJM1_occ.pir

Procheck score ⇒ Ramachandran plot: 94.6% favored    4.6% allowed    .8% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur