| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : R7WG03
dbSWEET id: dbswt_363
Accession: R7WG03
Uniprot status: Unreviewed
Organism: Aegilops tauschii
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Pooideae ⇒ Triticodae ⇒ Triticeae ⇒ Triticinae ⇒ Aegilops.
Sequence Information back to top
Sequence length: 287
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: TSVS CVV: 344 CHI: 1.9
Fasta sequence:
>tr|R7WG03|R7WG03_AEGTA|Unreviewed|Aegilops_tauschii|287
MGGLSLQHPWAFAFGLLGNVISFMTYLAPLPTFYRIYRSKSTQGFQSVPYVVALFSAMLW
IYYALLKSDELLLITINSAGCIIETIYIVMYLAYAPKQAKIFTAKILLLLNVGVFGLILL
LTLLLAGGEKRVVMLGWVCVGFSVSVFVAPLSIIRLVVRTRSVEFMPFSLSLSLTVSAVV
WFLYGLLIKDKYVALPNILGFAFGVIQMGLYAIYCNATPTLAPKEVDRPLPEHVINVAKL
GPTATIELNMPAAVQPPTKENIVACASGETKEISVEKVDMATNVEHV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 4 Model end: 216
Alignment file: R7WG03.pir
Inward Open:
Template: 5CTG.pdb
Model structure: R7WG03_inward.pdb
Procheck score ⇒ Ramachandran plot: 95.2% favored 3.2% allowed 1.1% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: R7WG03_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.6% favored 4.8% allowed 1.1% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: R7WG03_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.6% favored 5.3% allowed .5% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA