Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : R7WCM6

dbSWEET id: dbswt_370

Accession:   R7WCM6

Uniprot status:   Unreviewed

Organism:   Aegilops tauschii

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Pooideae ⇒ Triticodae ⇒ Triticeae ⇒ Triticinae ⇒ Aegilops.

Sequence Information back to top


Sequence length:   328

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   TNVS           CVV:   367       CHI:   -0.8

Fasta sequence:

>tr|R7WCM6|R7WCM6_AEGTA|Unreviewed|Aegilops_tauschii|328
MGGVSLQHPWAFAFGLLGNVISFMTYLAPLPTFYRIYRSKSTQGFQSVPYVVALFNAMLW
IYYALLKSNECLLITINSAGCIIETIYIVIYLTYAPKQAKLFTAKILLLLNVGVFGLILL
LTLLLSEGEKRVVMLGWVCVGFSVSVFIAPLSVILSTHPSYPMLVCIDPSNNSDKCIVPQ
SSQCLVVRTRSVEFMPFSLSLSLTISSVVWFLYGLLIKDKYVALPNILGFAFGVIQMGLC
AVYRNATPTTAPKDVDDPMTNHGTTVKAPEHVVHIAKLGPVAGLELNTHYPVKPGMPPPM
KENGKAHASVMTKGSVDKVDKATHIEQV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   4     Model end:   245

Alignment file: R7WCM6.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  R7WCM6_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.1% favored    7.5% allowed    .5% week    .9% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  R7WCM6_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.4% favored    4.2% allowed    1.4% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  R7WCM6_occluded.pdb

Procheck score ⇒ Ramachandran plot: 85.0% favored    11.2% allowed    2.3% week    1.4% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur