| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : R7WA53
dbSWEET id: dbswt_595
Accession: R7WA53
Uniprot status: Unreviewed
Organism: Aegilops tauschii
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Pooideae ⇒ Triticodae ⇒ Triticeae ⇒ Triticinae ⇒ Aegilops.
Sequence Information back to top
Sequence length: 231
Substrate Binding Site: CNFN CVV: 413 CHI: -1.7
Selectivity Filter: LNMM CVV: 468 CHI: 4.1
Fasta sequence:
>tr|R7WA53|R7WA53_AEGTA|Unreviewed|Aegilops_tauschii|231
MDSLSLYEISCFAAGFAGNLFAFALFLSPVPTFKRILKAKSTEQFDGLPYLLSLLNCFIC
LWYGLPWVSDGRLLVATVNGTGAAFQLAYISLFFIYADSRKTRLRMVGLLVLLVCAFALV
AHASIAFFDQPTRQQFVGAVSMASLISMFASPLAVMGVVIRTECVEFMPFYLSLSTLLMS
ASFAAYGVLLRDLFIYLPNGLGVVLGATQLTLYAYYSRKWRCKDTSAPLLA
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 4 Model end: 218
Alignment file: R7WA53.pir
Inward Open:
Template: 5CTG.pdb
Model structure: R7WA53_inward.pdb
Procheck score ⇒ Ramachandran plot: 96.3% favored 3.2% allowed .0% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: R7WA53_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.7% favored 5.3% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: R7WA53_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.6% favored 6.3% allowed 1.6% week .5% disallowed
Gene Ontologyback to top
GO:0005887 - integral component of plasma membrane
GO:0051119 - sugar transmembrane transporter activity
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA