Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : R7WA53

dbSWEET id: dbswt_595

Accession:   R7WA53

Uniprot status:   Unreviewed

Organism:   Aegilops tauschii

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Pooideae ⇒ Triticodae ⇒ Triticeae ⇒ Triticinae ⇒ Aegilops.

Sequence Information back to top


Sequence length:   231

Substrate Binding Site:   CNFN           CVV:   413       CHI:   -1.7

Selectivity Filter:   LNMM           CVV:   468       CHI:   4.1

Fasta sequence:

>tr|R7WA53|R7WA53_AEGTA|Unreviewed|Aegilops_tauschii|231
MDSLSLYEISCFAAGFAGNLFAFALFLSPVPTFKRILKAKSTEQFDGLPYLLSLLNCFIC
LWYGLPWVSDGRLLVATVNGTGAAFQLAYISLFFIYADSRKTRLRMVGLLVLLVCAFALV
AHASIAFFDQPTRQQFVGAVSMASLISMFASPLAVMGVVIRTECVEFMPFYLSLSTLLMS
ASFAAYGVLLRDLFIYLPNGLGVVLGATQLTLYAYYSRKWRCKDTSAPLLA

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   4     Model end:   218

Alignment file: R7WA53.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  R7WA53_inward.pdb

Procheck score ⇒ Ramachandran plot: 96.3% favored    3.2% allowed    .0% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  R7WA53_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.7% favored    5.3% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  R7WA53_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.6% favored    6.3% allowed    1.6% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0005887 - integral component of plasma membrane

GO:0051119 - sugar transmembrane transporter activity

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur