Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : R7W7H8

dbSWEET id: dbswt_438

Accession:   R7W7H8

Uniprot status:   Unreviewed

Organism:   Aegilops tauschii

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Pooideae ⇒ Triticodae ⇒ Triticeae ⇒ Triticinae ⇒ Aegilops.

Sequence Information back to top


Sequence length:   299

Substrate Binding Site:   TNWN           CVV:   448       CHI:   -8.6

Selectivity Filter:   VCMN           CVV:   411       CHI:   5.1

Fasta sequence:

>tr|R7W7H8|R7W7H8_AEGTA|Unreviewed|Aegilops_tauschii|299
MADPSFFVGIVGNIISILVFTSPIATFRRVVRNKSTEEFRWLPYVTTLLCTSLWAFYGLL
KPSGLLIITVNAAGAALQATYVALYLAYAPRDTKVKMAKVVVGVNICFFAAVVVVGLVAL
HGAVRLFAVGVLCSALTIAMYAAPMAAMRTVVKTRSVEYMPFSLSFFLFLNGGIWSVYSL
LVKDYFIGIPNAMGFVMGTAQLALYMAYQNKKKLAALKEEDEEKGVVHLMGQVELGQAKV
PSLKKGLSLPMPSSLPSPLHGFGNLIKALSATPLELQSVLNQHERVGDDDDDGHAYSSK

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   210

Alignment file: R7W7H8.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  R7W7H8_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.4% favored    5.4% allowed    1.1% week    2.2% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  R7W7H8_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.0% favored    5.4% allowed    1.1% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  R7W7H8_occluded.pdb

Procheck score ⇒ Ramachandran plot: 94.1% favored    4.3% allowed    1.6% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur