Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : R7TA68

dbSWEET id: dbswt_1229

Accession:   R7TA68

Uniprot status:   Unreviewed

Organism:   Capitella teleta

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Lophotrochozoa ⇒ Annelida ⇒ Polychaeta ⇒ Scolecida ⇒ Capitellida ⇒ Capitellidae ⇒ Capitella.

Sequence Information back to top


Sequence length:   216

Substrate Binding Site:   TNWN           CVV:   448       CHI:   -8.6

Selectivity Filter:   LNGV           CVV:   373       CHI:   4.1

Fasta sequence:

>tr|R7TA68|R7TA68_CAPTE|Unreviewed|Capitella_teleta|216
MILREFISALATVSTIGLYLTGIPICRKIVAKGSTQDTSFFPLIVMFCNTTLWVKYALIK
DDPTLLYANSVGSVLTFIYVSIYYLYTTHKTHVHRNLAFGAFLLFPILIYVKFYADNLDD
AVLYLGFVCSSVGVMGYGAPLSAMSEVLRTKSTECMAFPLSLANFIVAIEWFSYGFLLRD
FYIQVPNLIGIFLGGLQLALFWKYPSKKQTTASAVL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   206

Alignment file: R7TA68.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  R7TA68_inward.pdb

Procheck score ⇒ Ramachandran plot: 88.5% favored    7.7% allowed    1.6% week    2.2% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  R7TA68_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.3% favored    7.7% allowed    .5% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  R7TA68_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.3% favored    7.7% allowed    1.1% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur