Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : R7MTG0
dbSWEET id: dbswt_1902
Accession: R7MTG0
Uniprot status: Unreviewed
Organism: Streptococcus salivarius
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Streptococcus ⇒ environmental samples.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|R7MTG0|R7MTG0_9STRE|Unreviewed|Streptococcus salivarius|86
MSDKQMKTLGWVATFMSVMMYVSYVPQIMDNLSGHKGNFIQPLVAAINCSLWVYYGLFKK
ERDLPLAAANAPGIIFGLITALTALF
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 10 Model end: 86 Inward Open: Template: 4X5M.pdb Model structure: R7MTG0_inward.pdb Alignment file: R7MTG0_inw.pir Procheck score ⇒ Ramachandran plot: 87.7% favored 9.2% allowed 2.3% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: R7MTG0_outward.pdb Alignment file: R7MTG0_out.pir Procheck score ⇒ Ramachandran plot: 90.8% favored 7.7% allowed .8% week .8% disallowed Occluded: Model structure: R7MTG0_occluded.pdb Alignment file: R7MTG0_occ.pir Procheck score ⇒ Ramachandran plot: 86.9% favored 10.8% allowed 2.3% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA