Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : R5ZD72
dbSWEET id: dbswt_1900
Accession: R5ZD72
Uniprot status: Unreviewed
Organism: Lactobacillus amylovorus
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus ⇒ environmental samples.
Sequence Information back to top
Sequence length: 87
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: YNYN CVV: 474 CHI: -9.6
Fasta sequence:
>tr|R5ZD72|R5ZD72_9LACO|Unreviewed|Lactobacillus amylovorus|87
MTKEQRYLAIGRVASIISVLMYVSYIAQIISNLNGQKGNPIQPLIAAINASLWVAYGWNA
PQKRDWPIIVANAPGVVLGIITAITCM
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 12 Model end: 88 Inward Open: Template: 4X5M.pdb Model structure: R5ZD72_inward.pdb Alignment file: R5ZD72_inw.pir Procheck score ⇒ Ramachandran plot: 93.0% favored 4.7% allowed 2.3% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: R5ZD72_outward.pdb Alignment file: R5ZD72_out.pir Procheck score ⇒ Ramachandran plot: 91.4% favored 7.8% allowed .8% week .0% disallowed Occluded: Model structure: R5ZD72_occluded.pdb Alignment file: R5ZD72_occ.pir Procheck score ⇒ Ramachandran plot: 91.4% favored 3.9% allowed 2.3% week 2.3% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA