Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : R5ZD72

dbSWEET id: dbswt_1900

Accession:   R5ZD72

Uniprot status:   Unreviewed

Organism:   Lactobacillus amylovorus

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus ⇒ environmental samples.

Sequence Information back to top


Sequence length:   87

Substrate Binding Site:   ANAN           CVV:   326       CHI:   -3.4

Selectivity Filter:   YNYN           CVV:   474       CHI:   -9.6

Fasta sequence:

>tr|R5ZD72|R5ZD72_9LACO|Unreviewed|Lactobacillus amylovorus|87
MTKEQRYLAIGRVASIISVLMYVSYIAQIISNLNGQKGNPIQPLIAAINASLWVAYGWNA
PQKRDWPIIVANAPGVVLGIITAITCM

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   12     Model end:   88

Inward Open:

Template:   4X5M.pdb

Model structure:  R5ZD72_inward.pdb    Alignment file: R5ZD72_inw.pir

Procheck score ⇒ Ramachandran plot: 93.0% favored    4.7% allowed    2.3% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  R5ZD72_outward.pdb    Alignment file: R5ZD72_out.pir

Procheck score ⇒ Ramachandran plot: 91.4% favored    7.8% allowed    .8% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  R5ZD72_occluded.pdb    Alignment file: R5ZD72_occ.pir

Procheck score ⇒ Ramachandran plot: 91.4% favored    3.9% allowed    2.3% week    2.3% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur