Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : R4RTC5
dbSWEET id: dbswt_1899
Accession: R4RTC5
Uniprot status: Unreviewed
Organism: Lactobacillus fermentum
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 95
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|R4RTC5|R4RTC5_LACFE|Unreviewed|Lactobacillus fermentum|95
MMSKEELNRRLHQAKIVGNTATIACLIMYTSYIQQIISNFTGHPVSPLQPICASINALLW
VAYGWIKPKKDWPVIIANFPGIIFGILTFVTAYLH
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 18 Model end: 94 Inward Open: Template: 4X5M.pdb Model structure: R4RTC5_inward.pdb Alignment file: R4RTC5_inw.pir Procheck score ⇒ Ramachandran plot: 86.7% favored 10.9% allowed 1.6% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: R4RTC5_outward.pdb Alignment file: R4RTC5_out.pir Procheck score ⇒ Ramachandran plot: 89.8% favored 8.6% allowed .8% week .8% disallowed Occluded: Model structure: R4RTC5_occluded.pdb Alignment file: R4RTC5_occ.pir Procheck score ⇒ Ramachandran plot: 91.4% favored 5.5% allowed 2.3% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA