| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : R4G498
dbSWEET id: dbswt_1228
Accession: R4G498
Uniprot status: Unreviewed
Organism: Rhodnius prolixus
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Paraneoptera ⇒ Hemiptera ⇒ Euhemiptera ⇒ Heteroptera ⇒ Panheteroptera ⇒ Cimicomorpha ⇒ Reduviidae ⇒ Triatominae ⇒ Rhodnius.
Sequence Information back to top
Sequence length: 214
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: QILV CVV: 467 CHI: 9
Fasta sequence:
>tr|R4G498|R4G498_RHOPR|Unreviewed|Rhodnius_prolixus|214
MGLEDYKNIVGAAAGIATIAQFFSPLIICRNIIQQKDTRNVDPTPFIGGIGISLLMLQHG
LILNDPAMIPVNIVGLILNIVYLSVFYTYTKDKFDVFRSLGKVIAGVAVLITYAQLESEE
RIEFNFGVIVTILLLTLIGAPLFNLKEILRSQDTSSLPFPMISCGTVVTFLWLLYGIIIK
NIFIQIQNVVGCTLCSVQLALCLMYPGKPRRKVE
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 207
Alignment file: R4G498.pir
Inward Open:
Template: 5CTG.pdb
Model structure: R4G498_inward.pdb
Procheck score ⇒ Ramachandran plot: 88.4% favored 8.3% allowed 1.1% week 2.2% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: R4G498_outward.pdb
Procheck score ⇒ Ramachandran plot: 89.5% favored 9.4% allowed .6% week .6% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: R4G498_occluded.pdb
Procheck score ⇒ Ramachandran plot: 87.3% favored 9.4% allowed 2.8% week .6% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA