Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : R3I0F3
dbSWEET id: dbswt_1898
Accession: R3I0F3
Uniprot status: Unreviewed
Organism: Enterococcus faecalis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Enterococcaceae ⇒ Enterococcus.
Sequence Information back to top
Sequence length: 90
Substrate Binding Site: WNWN CVV: 518 CHI: -8.8
Selectivity Filter: SFSF CVV: 416 CHI: 4
Fasta sequence:
>tr|R3I0F3|R3I0F3_ENTFL|Unreviewed|Enterococcus faecalis|90
MKKNKKVLHAIAVIASVMSVLMYVSYIPQIYGNLHGEKGNPTQPLVAIINCIFWTIHGLY
GDDGETRDKSIIFANVPGIIFGFFAFITAL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 12 Model end: 91 Inward Open: Template: 4X5M.pdb Model structure: R3I0F3_inward.pdb Alignment file: R3I0F3_inw.pir Procheck score ⇒ Ramachandran plot: 89.2% favored 10.0% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: R3I0F3_outward.pdb Alignment file: R3I0F3_out.pir Procheck score ⇒ Ramachandran plot: 88.5% favored 10.8% allowed .8% week .0% disallowed Occluded: Model structure: R3I0F3_occluded.pdb Alignment file: R3I0F3_occ.pir Procheck score ⇒ Ramachandran plot: 89.2% favored 10.8% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA