| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : R2VI86
dbSWEET id: dbswt_1897
Accession: R2VI86
Uniprot status: Unreviewed
Organism: Enterococcus gilvus
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Enterococcaceae ⇒ Enterococcus.
Sequence Information back to top
Sequence length: 88
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|R2VI86|R2VI86_9ENTE|Unreviewed|Enterococcus gilvus|88
MNKKERTVQIFGRIASVLSVLMYVSYIPQIMNNLAGDKGNPIQPMVAMVNCIFWVIYASM
QKKKDYPIIIANVPGVFLGAITFITALM
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 12 Model end: 88 Inward Open: Template: 4X5M.pdb Model structure: R2VI86_inward.pdb Alignment file: R2VI86_inw.pir Procheck score ⇒ Ramachandran plot: 88.5% favored 10.8% allowed .0% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: R2VI86_outward.pdb Alignment file: R2VI86_out.pir Procheck score ⇒ Ramachandran plot: 95.4% favored 4.6% allowed .0% week .0% disallowed Occluded: Model structure: R2VI86_occluded.pdb Alignment file: R2VI86_occ.pir Procheck score ⇒ Ramachandran plot: 89.2% favored 9.2% allowed .8% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA