Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : R2RQ87
dbSWEET id: dbswt_1895
Accession: R2RQ87
Uniprot status: Unreviewed
Organism: Enterococcus raffinosus
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Enterococcaceae ⇒ Enterococcus.
Sequence Information back to top
Sequence length: 88
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|R2RQ87|R2RQ87_9ENTE|Unreviewed|Enterococcus raffinosus|88
MSKKDHTILVFGRIASVLSVLMYVSYIPQIMNNLAGNKGNPIQPMVAMVNCIFWVIYASM
QKKKDYPIIIANVPGVFLGAITFITAIM
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 12 Model end: 88 Inward Open: Template: 4X5M.pdb Model structure: R2RQ87_inward.pdb Alignment file: R2RQ87_inw.pir Procheck score ⇒ Ramachandran plot: 90.8% favored 8.5% allowed .0% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: R2RQ87_outward.pdb Alignment file: R2RQ87_out.pir Procheck score ⇒ Ramachandran plot: 94.6% favored 3.8% allowed 1.5% week .0% disallowed Occluded: Model structure: R2RQ87_occluded.pdb Alignment file: R2RQ87_occ.pir Procheck score ⇒ Ramachandran plot: 93.8% favored 6.2% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA