Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : R2QKC6

dbSWEET id: dbswt_1894

Accession:   R2QKC6

Uniprot status:   Unreviewed

Organism:   Enterococcus moraviensis

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Enterococcaceae ⇒ Enterococcus.

Sequence Information back to top


Sequence length:   84

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|R2QKC6|R2QKC6_9ENTE|Unreviewed|Enterococcus moraviensis|84
MDKFIKYLSWIATITAILMYVSYIPQIANNLNGQKGNPIQPVVAAINCTLWTSYGFLKRP
RDYPIVIANFPGVIFGLIAFLTSI

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   9     Model end:   85

Inward Open:

Template:   4X5M.pdb

Model structure:  R2QKC6_inward.pdb    Alignment file: R2QKC6_inw.pir

Procheck score ⇒ Ramachandran plot: 86.5% favored    11.1% allowed    .8% week    1.6% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  R2QKC6_outward.pdb    Alignment file: R2QKC6_out.pir

Procheck score ⇒ Ramachandran plot: 91.3% favored    7.9% allowed    .0% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  R2QKC6_occluded.pdb    Alignment file: R2QKC6_occ.pir

Procheck score ⇒ Ramachandran plot: 93.7% favored    5.6% allowed    .8% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur