Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : R1IWK0

dbSWEET id: dbswt_1893

Accession:   R1IWK0

Uniprot status:   Unreviewed

Organism:   Grimontia indica

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Gammaproteobacteria ⇒ Vibrionales ⇒ Vibrionaceae ⇒ Grimontia.

Sequence Information back to top


Sequence length:   97

Substrate Binding Site:   ANAN           CVV:   326       CHI:   -3.4

Selectivity Filter:   AIAI           CVV:   382       CHI:   12.6

Fasta sequence:

>tr|R1IWK0|R1IWK0_9GAMM|Unreviewed|Grimontia indica|97
MSVIEKIGKALEPLMLVMGLVSPLATLPQIYKLYFSHSEHAAGLSLTTWVLYSFIAMLWT
FYGLYHKNPTIWVGNGLGFLMYIAMVAGIIARVGITF

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   12     Model end:   91

Inward Open:

Template:   4X5M.pdb

Model structure:  R1IWK0_inward.pdb    Alignment file: R1IWK0_inw.pir

Procheck score ⇒ Ramachandran plot: 90.2% favored    9.1% allowed    .0% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  R1IWK0_outward.pdb    Alignment file: R1IWK0_out.pir

Procheck score ⇒ Ramachandran plot: 94.7% favored    5.3% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  R1IWK0_occluded.pdb    Alignment file: R1IWK0_occ.pir

Procheck score ⇒ Ramachandran plot: 93.2% favored    3.0% allowed    2.3% week    1.5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur