Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : R0I8G4
dbSWEET id: dbswt_854
Accession: R0I8G4
Uniprot status: Unreviewed
Organism: Capsella rubella
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Camelineae ⇒ Capsella.
Sequence Information back to top
Sequence length: 212
Substrate Binding Site: CNWS CVV: 418 CHI: -2.7
Selectivity Filter: IKVN CVV: 460 CHI: 1.3
Fasta sequence:
>tr|R0I8G4|R0I8G4_9BRAS|Unreviewed|Capsella_rubella|212
MIIIAKDIRIIIGVIGKMICISLLRANKKLSVGEYQHDRQIVIMTKCSLWILYGIPFVYK
DGILVTTSNGLGFIIEAIYLVIVWINCDNKKMVFGSLLWASGFVSTFYVITLMIFARSPY
KHILVGVVCDVFNICVYLNISLNKMSETKNYTYMPFWLSVVSFINAGSWTAYSLIYKIDI
FVLINSGVETLFCAFQLVVHACSCIRQLCVSV
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 205
Alignment file: R0I8G4.pir
Inward Open:
Template: 5CTG.pdb
Model structure: R0I8G4_inward.pdb
Procheck score ⇒ Ramachandran plot: 85.6% favored 9.1% allowed 3.2% week 2.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: R0I8G4_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.4% favored 7.5% allowed .5% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: R0I8G4_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.4% favored 7.0% allowed 1.6% week .0% disallowed
Gene Informationback to top
Gene ID: 17893172 Total Exons: 5 Coding Exons: 5
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA