| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : R0HH22
dbSWEET id: dbswt_244
Accession: R0HH22
Uniprot status: Unreviewed
Organism: Capsella rubella
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Camelineae ⇒ Capsella.
Sequence Information back to top
Sequence length: 260
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVN CVV: 379 CHI: 4.1
Fasta sequence:
>tr|R0HH22|R0HH22_9BRAS|Unreviewed|Capsella_rubella|260
MVFIKVHQLAFFFGLMGNIVSFGVFLSPVPTFYGIYKKKSSKGFQSIPYICALASATLLL
YYGIMKTHAYLIISINTFGCFIEITYLFLYIFYAPREARIFTLKLIVICNIGGLGLLILL
VNLLVPKPHRVSTVGWVCAAYSLAVFASPLSVMRKVIKTKSVEYMPFLLSLSLTLNAVMW
FFYGLLIKDKFIAMPNILGFLFGVAQMILYMMYQGSTKTDLPTEHQLGNKTDVNEIAVVA
VELPDARLDNVEGSARPAMK
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 3 Model end: 215
Alignment file: R0HH22.pir
Inward Open:
Template: 5CTG.pdb
Model structure: R0HH22_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.0% favored 6.4% allowed 1.1% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: R0HH22_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.0% favored 5.9% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: R0HH22_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.0% favored 6.4% allowed 1.1% week .5% disallowed
Gene Informationback to top
Gene ID: 17888119 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA