Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : R0GPT4
dbSWEET id: dbswt_883
Accession: R0GPT4
Uniprot status: Unreviewed
Organism: Capsella rubella
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Camelineae ⇒ Capsella.
Sequence Information back to top
Sequence length: 239
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMN CVV: 440 CHI: -1.3
Fasta sequence:
>tr|R0GPT4|R0GPT4_9BRAS|Unreviewed|Capsella_rubella|239
MTDAHAARTVVGIIGNVISFGLFCAPIPTMVKIWKMKSVSEFKPDPYVATVLNCMMWTFY
GLPFVQPDSLLVITINGTGLFMELVYVTIFFIFATSPVRRKITIAMVIEVIFMVVVIFCT
LYFLHTTKQRSMLIGILCIIFNVIMYAAPLTVMKLVIKTKSVKYMPFFLSLANFMNGVVW
VIYACLKFDPYILIPNGLGSLSGIVQLILYVTYYKTTNWNDDEDDEKRYSNAGIELGQA
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 215
Alignment file: R0GPT4.pir
Inward Open:
Template: 5CTG.pdb
Model structure: R0GPT4_inward.pdb
Procheck score ⇒ Ramachandran plot: 95.3% favored 3.7% allowed 1.1% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: R0GPT4_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.2% favored 5.8% allowed .0% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: R0GPT4_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.1% favored 6.3% allowed 1.6% week .0% disallowed
Gene Informationback to top
Gene ID: 17875694 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA