Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : R0G782

dbSWEET id: dbswt_508

Accession:   R0G782

Uniprot status:   Unreviewed

Organism:   Capsella rubella

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Camelineae ⇒ Capsella.

Sequence Information back to top


Sequence length:   242

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   VSMN           CVV:   398       CHI:   1.8

Fasta sequence:

>tr|R0G782|R0G782_9BRAS|Unreviewed|Capsella_rubella|242
LPLISPSHNMADLSFYVGVIGNVISVLVFLSPVETFWKIVKGRSTEEYECLPYVCTLMSS
SLWTYYGIVTPGEYLVSTVNGFGALAESIYVLIFLFFVPKSRFLKTVAMVLALNVCFPVI
AILGTRTAFGDANSRSTSMGFICATLNIIMYGSPLSVIKTVVTTRSVQFMPFWLSFFLFL
NGAIWGVYALLLHDVFLLVPNGMGFLLGTVQLLIYAYYRNARPNVQDHEEGLIIPPSQPL
LS

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   7     Model end:   220

Alignment file: R0G782.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  R0G782_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.1% favored    3.7% allowed    1.1% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  R0G782_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.6% favored    5.3% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  R0G782_occluded.pdb

Procheck score ⇒ Ramachandran plot: 89.8% favored    10.2% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur