Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : R0G782
dbSWEET id: dbswt_508
Accession: R0G782
Uniprot status: Unreviewed
Organism: Capsella rubella
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Camelineae ⇒ Capsella.
Sequence Information back to top
Sequence length: 242
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: VSMN CVV: 398 CHI: 1.8
Fasta sequence:
>tr|R0G782|R0G782_9BRAS|Unreviewed|Capsella_rubella|242
LPLISPSHNMADLSFYVGVIGNVISVLVFLSPVETFWKIVKGRSTEEYECLPYVCTLMSS
SLWTYYGIVTPGEYLVSTVNGFGALAESIYVLIFLFFVPKSRFLKTVAMVLALNVCFPVI
AILGTRTAFGDANSRSTSMGFICATLNIIMYGSPLSVIKTVVTTRSVQFMPFWLSFFLFL
NGAIWGVYALLLHDVFLLVPNGMGFLLGTVQLLIYAYYRNARPNVQDHEEGLIIPPSQPL
LS
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 7 Model end: 220
Alignment file: R0G782.pir
Inward Open:
Template: 5CTG.pdb
Model structure: R0G782_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.1% favored 3.7% allowed 1.1% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: R0G782_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.6% favored 5.3% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: R0G782_occluded.pdb
Procheck score ⇒ Ramachandran plot: 89.8% favored 10.2% allowed .0% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA