Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : R0FCY6
dbSWEET id: dbswt_944
Accession: R0FCY6
Uniprot status: Unreviewed
Organism: Capsella rubella
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Camelineae ⇒ Capsella.
Sequence Information back to top
Sequence length: 230
Substrate Binding Site: INVS CVV: 398 CHI: 4.4
Selectivity Filter: LMVI CVV: 477 CHI: 14.4
Fasta sequence:
>tr|R0FCY6|R0FCY6_9BRAS|Unreviewed|Capsella_rubella|230
MSSAKVLRTIIGIIGMIAHLLYLSLLQPRFLHIYKKKSVEDYIPTRHIALVMIHGLWVLY
GLPLFHKDGILVTTSNGIGCLIEIIYLVVFLIYCSDESCRSNTWYSLASGIPLVLVLLYG
TSLTESESLSTLHITIGVICDVLTTGVDIKIALTYENVPVWFYLAKFINAGVWLAYSLIY
KLDIFVLISSGLGMLLCASQLIFCSNRPIKPAQSNAADTLPQLSTYVGVV
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 209
Alignment file: R0FCY6.pir
Inward Open:
Template: 5CTG.pdb
Model structure: R0FCY6_inward.pdb
Procheck score ⇒ Ramachandran plot: 72.2% favored 11.8% allowed 9.6% week 6.4% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: R0FCY6_outward.pdb
Procheck score ⇒ Ramachandran plot: 88.8% favored 9.6% allowed 1.1% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: R0FCY6_occluded.pdb
Procheck score ⇒ Ramachandran plot: 89.8% favored 9.1% allowed .5% week .5% disallowed
Gene Informationback to top
Gene ID: 17881606 Total Exons: 5 Coding Exons: 5
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA