Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : R0FCY6

dbSWEET id: dbswt_944

Accession:   R0FCY6

Uniprot status:   Unreviewed

Organism:   Capsella rubella

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Camelineae ⇒ Capsella.

Sequence Information back to top


Sequence length:   230

Substrate Binding Site:   INVS           CVV:   398       CHI:   4.4

Selectivity Filter:   LMVI           CVV:   477       CHI:   14.4

Fasta sequence:

>tr|R0FCY6|R0FCY6_9BRAS|Unreviewed|Capsella_rubella|230
MSSAKVLRTIIGIIGMIAHLLYLSLLQPRFLHIYKKKSVEDYIPTRHIALVMIHGLWVLY
GLPLFHKDGILVTTSNGIGCLIEIIYLVVFLIYCSDESCRSNTWYSLASGIPLVLVLLYG
TSLTESESLSTLHITIGVICDVLTTGVDIKIALTYENVPVWFYLAKFINAGVWLAYSLIY
KLDIFVLISSGLGMLLCASQLIFCSNRPIKPAQSNAADTLPQLSTYVGVV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   209

Alignment file: R0FCY6.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  R0FCY6_inward.pdb

Procheck score ⇒ Ramachandran plot: 72.2% favored    11.8% allowed    9.6% week    6.4% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  R0FCY6_outward.pdb

Procheck score ⇒ Ramachandran plot: 88.8% favored    9.6% allowed    1.1% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  R0FCY6_occluded.pdb

Procheck score ⇒ Ramachandran plot: 89.8% favored    9.1% allowed    .5% week    .5% disallowed

Gene Informationback to top


Gene ID:   17881606     Total Exons:   5     Coding Exons:   5

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur