Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : R0F074

dbSWEET id: dbswt_208

Accession:   R0F074

Uniprot status:   Unreviewed

Organism:   Capsella rubella

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Camelineae ⇒ Capsella.

Sequence Information back to top


Sequence length:   290

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>tr|R0F074|R0F074_9BRAS|Unreviewed|Capsella_rubella|290
MAISQAVLATVFGILGNVISFFVCLAPIPTFIRIYKRKSSEGYQSVPYVISLFSAMLWLY
YAMIKKDAVMLITINSFAFVIQIVYISLFFFYAPKKDKILTVKFVLFVDVFAFGLIFFST
YFPIHGNKRVQVLGYICMVFALSVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAVMWF
FYGLLLKDKNIALPNVLGFIFGVLQMVLFVIYKKPGTKVLEPSVIKLQDISEHVVDVVRL
SSMVCNSQMRTLVPQDSADMEDTIDIEEKMKGDIEKNKDNNKEAFLISKN

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   2     Model end:   214

Alignment file: R0F074.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  R0F074_inward.pdb

Procheck score ⇒ Ramachandran plot: 92.7% favored    5.2% allowed    .5% week    1.6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  R0F074_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.2% favored    3.7% allowed    2.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  R0F074_occluded.pdb

Procheck score ⇒ Ramachandran plot: 94.2% favored    5.2% allowed    .5% week    .0% disallowed

Gene Informationback to top


Gene ID:   17876935     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF22

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur