Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : R0EV96

dbSWEET id: dbswt_571

Accession:   R0EV96

Uniprot status:   Unreviewed

Organism:   Capsella rubella

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Camelineae ⇒ Capsella.

Sequence Information back to top


Sequence length:   264

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   LNMA           CVV:   411       CHI:   4

Fasta sequence:

>tr|R0EV96|R0EV96_9BRAS|Unreviewed|Capsella_rubella|264
MGDKLRLSIGVLGNGASLLLYTAPILTFARVFKKKSTEEFSCFPYVMTLFNCLIYTWYGL
PIVSHLWENLPLVTINGVGILLESFFIFIYFWYASPKEKIKVGVTLVPVIVLFGLTTAIS
AVVFDDHRHRKSFVGSVGLVASISMYGSPLIVMKKVIETKSVEYMPFYLSFFSFLASSLW
LAYGLLSHDLFLASPNMVATPLGILQLIIYFKYKNKKVLTPTTMVMSKRNDHDDGEKNKT
TLELVFDVDRDRDDANEKNQNNAC

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   215

Alignment file: R0EV96.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  R0EV96_inward.pdb

Procheck score ⇒ Ramachandran plot: 89.9% favored    8.0% allowed    1.6% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  R0EV96_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.1% favored    4.8% allowed    .5% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  R0EV96_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.5% favored    7.4% allowed    .0% week    1.1% disallowed

Gene Informationback to top


Gene ID:   17877239     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur