Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : Q9ZV02
dbSWEET id: dbswt_246
Accession: Q9ZV02
Uniprot status: Reviewed
Organism: Arabidopsis thaliana
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Camelineae ⇒ Arabidopsis.
Sequence Information back to top
Sequence length: 258
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVN CVV: 379 CHI: 4.1
Fasta sequence:
>sp|Q9ZV02|SWET9_ARATH|Reviewed|Arabidopsis_thaliana|258
MFLKVHEIAFLFGLLGNIVSFGVFLSPVPTFYGIYKKKSSKGFQSIPYICALASATLLLY
YGIMKTHAYLIISINTFGCFIEISYLFLYILYAPREAKISTLKLIVICNIGGLGLLILLV
NLLVPKQHRVSTVGWVCAAYSLAVFASPLSVMRKVIKTKSVEYMPFLLSLSLTLNAVMWF
FYGLLIKDKFIAMPNILGFLFGVAQMILYMMYQGSTKTDLPTENQLANKTDVNEVPIVAV
ELPDVGSDNVEGSVRPMK
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 2 Model end: 214
Alignment file: Q9ZV02.pir
Inward Open:
Template: 5CTG.pdb
Model structure: Q9ZV02_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.6% favored 4.3% allowed 2.7% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: Q9ZV02_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.1% favored 5.9% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: Q9ZV02_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.0% favored 7.4% allowed .5% week .0% disallowed
Gene Informationback to top
Gene ID: 818492 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0030659 - cytoplasmic vesicle membrane
GO:0016021 - integral component of membrane
GO:0005887 - integral component of plasma membrane
GO:0005886 - plasma membrane
GO:0032588 - trans-Golgi network membrane
GO:0012506 - vesicle membrane
GO:0008515 - sucrose transmembrane transporter activity
GO:0051119 - sugar transmembrane transporter activity
GO:0071836 - nectar secretion
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA