Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : Q9XX26
dbSWEET id: dbswt_1227
Accession: Q9XX26
Uniprot status: Unreviewed
Organism: Caenorhabditis elegans
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Rhabditoidea ⇒ Rhabditidae ⇒ Peloderinae ⇒ Caenorhabditis.
Sequence Information back to top
Sequence length: 225
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: FSSV CVV: 386 CHI: 5.4
Fasta sequence:
>tr|Q9XX26|Q9XX26_CAEEL|Unreviewed|Caenorhabditis_elegans|225
MTTSLGQTILPYLSFTALSSTVAFFLCGLQICHRIKTRGSSEGTSPAPFLLSFLSCGLFI
QYGLLKDDDVITYCNGIGCFLQACYLMYFYYMTRNRRFLNKVISIELGIIGIVVYWVAHS
TNSHLTKTTYVGNYCIFLNICSVAAPLFDIGKVVRNKSSESLPLPLCVACFVVCLQWMFY
GYIVDDIVILVPNVIATVISILQLSLFIIYPGAPAGVLPQKYEHI
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 3 Model end: 212
Alignment file: Q9XX26.pir
Inward Open:
Template: 5CTG.pdb
Model structure: Q9XX26_inward.pdb
Procheck score ⇒ Ramachandran plot: 89.3% favored 6.4% allowed 2.7% week 1.6% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: Q9XX26_outward.pdb
Procheck score ⇒ Ramachandran plot: 89.8% favored 9.6% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: Q9XX26_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.4% favored 5.9% allowed 2.1% week .5% disallowed
Gene Informationback to top
Gene ID: 189708 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA