Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : Q9XX26

dbSWEET id: dbswt_1227

Accession:   Q9XX26

Uniprot status:   Unreviewed

Organism:   Caenorhabditis elegans

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Rhabditoidea ⇒ Rhabditidae ⇒ Peloderinae ⇒ Caenorhabditis.

Sequence Information back to top


Sequence length:   225

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   FSSV           CVV:   386       CHI:   5.4

Fasta sequence:

>tr|Q9XX26|Q9XX26_CAEEL|Unreviewed|Caenorhabditis_elegans|225
MTTSLGQTILPYLSFTALSSTVAFFLCGLQICHRIKTRGSSEGTSPAPFLLSFLSCGLFI
QYGLLKDDDVITYCNGIGCFLQACYLMYFYYMTRNRRFLNKVISIELGIIGIVVYWVAHS
TNSHLTKTTYVGNYCIFLNICSVAAPLFDIGKVVRNKSSESLPLPLCVACFVVCLQWMFY
GYIVDDIVILVPNVIATVISILQLSLFIIYPGAPAGVLPQKYEHI

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   3     Model end:   212

Alignment file: Q9XX26.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  Q9XX26_inward.pdb

Procheck score ⇒ Ramachandran plot: 89.3% favored    6.4% allowed    2.7% week    1.6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  Q9XX26_outward.pdb

Procheck score ⇒ Ramachandran plot: 89.8% favored    9.6% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  Q9XX26_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.4% favored    5.9% allowed    2.1% week    .5% disallowed

Gene Informationback to top


Gene ID:   189708     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur