Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : Q9VUN8
dbSWEET id: dbswt_1226
Accession: Q9VUN8
Uniprot status: Unreviewed
Organism: Drosophila melanogaster
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Brachycera ⇒ Muscomorpha ⇒ Ephydroidea ⇒ Drosophilidae ⇒ Drosophila ⇒ Sophophora.
Sequence Information back to top
Sequence length: 228
Substrate Binding Site: TNWN CVV: 448 CHI: -8.6
Selectivity Filter: QLMV CVV: 467 CHI: 6.4
Fasta sequence:
>tr|Q9VUN8|Q9VUN8_DROME|Unreviewed|Drosophila_melanogaster|228
MEALGDLLAPHSELIAKVAGTITTLQFLSGVVLMNDIRKKGSSDVYPVGPFLFGVVLTVL
SLKLANIMNDAAMINTNLIGLVINFVFLFGFYYYASSASRSKIWKQIGYSSVFLLAITAY
ANFEDPAKIEFRLGMLITGILVWMVGSPLLHLPKIIEKKSTEGMPFPIIFAGNLVAFSWT
LYAISIKNTVMVLQNLLLLVLGGIQLSMFAIYPNKPAAEKPKDSKKDK
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 5 Model end: 214
Alignment file: Q9VUN8.pir
Inward Open:
Template: 5CTG.pdb
Model structure: Q9VUN8_inward.pdb
Procheck score ⇒ Ramachandran plot: 88.6% favored 7.6% allowed 2.7% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: Q9VUN8_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.6% favored 4.3% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: Q9VUN8_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.4% favored 5.4% allowed 1.1% week 1.1% disallowed
Gene Informationback to top
Gene ID: 39670 Total Exons: 3 Coding Exons: 3
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0005794 - Golgi apparatus
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0034219 - carbohydrate transmembrane transport
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF5