Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : Q9LUR4

dbSWEET id: dbswt_507

Accession:   Q9LUR4

Uniprot status:   Reviewed

Organism:   Arabidopsis thaliana

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Camelineae ⇒ Arabidopsis.

Sequence Information back to top


Sequence length:   230

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   VSMN           CVV:   398       CHI:   1.8

Fasta sequence:

>sp|Q9LUR4|SWT16_ARATH|Reviewed|Arabidopsis_thaliana|230
MADLSFYVGVIGNVISVLVFLSPVETFWRIVQRRSTEEYECFPYICTLMSSSLWTYYGIV
TPGEYLVSTVNGFGALAESIYVLIFLFFVPKSRFLKTVVVVLALNVCFPVIAIAGTRTLF
GDANSRSSSMGFICATLNIIMYGSPLSAIKTVVTTRSVQFMPFWLSFFLFLNGAIWGVYA
LLLHDMFLLVPNGMGFFLGIMQLLIYAYYRNAEPIVEDEEGLIPNQPLLA

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   211

Alignment file: Q9LUR4.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  Q9LUR4_inward.pdb

Procheck score ⇒ Ramachandran plot: 95.1% favored    2.7% allowed    1.1% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  Q9LUR4_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.1% favored    5.4% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  Q9LUR4_occluded.pdb

Procheck score ⇒ Ramachandran plot: 94.1% favored    5.4% allowed    .5% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005887 - integral component of plasma membrane

GO:0009705 - plant-type vacuole membrane

GO:0005353 - fructose transmembrane transporter activity

GO:0005355 - glucose transmembrane transporter activity

GO:0008515 - sucrose transmembrane transporter activity

GO:0051119 - sugar transmembrane transporter activity

GO:0006995 - cellular response to nitrogen starvation

GO:1902334 - fructose export from vacuole to cytoplasm

GO:0051260 - protein homooligomerization

GO:0009409 - response to cold

GO:0009750 - response to fructose

GO:0009749 - response to glucose

GO:0006970 - response to osmotic stress

GO:0009744 - response to sucrose

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur