| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : Q9LUR4
dbSWEET id: dbswt_507
Accession: Q9LUR4
Uniprot status: Reviewed
Organism: Arabidopsis thaliana
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Camelineae ⇒ Arabidopsis.
Sequence Information back to top
Sequence length: 230
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: VSMN CVV: 398 CHI: 1.8
Fasta sequence:
>sp|Q9LUR4|SWT16_ARATH|Reviewed|Arabidopsis_thaliana|230
MADLSFYVGVIGNVISVLVFLSPVETFWRIVQRRSTEEYECFPYICTLMSSSLWTYYGIV
TPGEYLVSTVNGFGALAESIYVLIFLFFVPKSRFLKTVVVVLALNVCFPVIAIAGTRTLF
GDANSRSSSMGFICATLNIIMYGSPLSAIKTVVTTRSVQFMPFWLSFFLFLNGAIWGVYA
LLLHDMFLLVPNGMGFFLGIMQLLIYAYYRNAEPIVEDEEGLIPNQPLLA
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 211
Alignment file: Q9LUR4.pir
Inward Open:
Template: 5CTG.pdb
Model structure: Q9LUR4_inward.pdb
Procheck score ⇒ Ramachandran plot: 95.1% favored 2.7% allowed 1.1% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: Q9LUR4_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.1% favored 5.4% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: Q9LUR4_occluded.pdb
Procheck score ⇒ Ramachandran plot: 94.1% favored 5.4% allowed .5% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005887 - integral component of plasma membrane
GO:0009705 - plant-type vacuole membrane
GO:0005353 - fructose transmembrane transporter activity
GO:0005355 - glucose transmembrane transporter activity
GO:0008515 - sucrose transmembrane transporter activity
GO:0051119 - sugar transmembrane transporter activity
GO:0006995 - cellular response to nitrogen starvation
GO:1902334 - fructose export from vacuole to cytoplasm
GO:0051260 - protein homooligomerization
GO:0009409 - response to cold
GO:0009750 - response to fructose
GO:0009749 - response to glucose
GO:0006970 - response to osmotic stress
GO:0009744 - response to sucrose
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA