Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : Q9LH79
dbSWEET id: dbswt_650
Accession: Q9LH79
Uniprot status: Reviewed
Organism: Arabidopsis thaliana
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Camelineae ⇒ Arabidopsis.
Sequence Information back to top
Sequence length: 236
Substrate Binding Site: CNFN CVV: 413 CHI: -1.7
Selectivity Filter: LNMM CVV: 468 CHI: 4.1
Fasta sequence:
>sp|Q9LH79|SWET2_ARATH|Reviewed|Arabidopsis_thaliana|236
MDVFAFNASLSMCKDVAGIAGNIFAFGLFVSPMPTFRRIMRNKSTEQFSGLPYIYALLNC
LICLWYGTPFISHSNAMLMTVNSVGATFQLCYIILFIMHTDKKNKMKMLGLLFVVFAVVG
VIVAGSLQIPDQLTRWYFVGFLSCGSLVSMFASPLFVINLVIRTKSVEFMPFYLSLSTFL
MSASFLLYGLFNSDAFVYTPNGIGTILGIVQLALYCYYHRNSIEEETKEPLIVSYV
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 7 Model end: 220
Alignment file: Q9LH79.pir
Inward Open:
Template: 5CTG.pdb
Model structure: Q9LH79_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.1% favored 5.9% allowed .5% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: Q9LH79_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.6% favored 5.3% allowed .5% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: Q9LH79_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.5% favored 6.4% allowed 1.6% week .5% disallowed
Gene Informationback to top
Gene ID: 820705 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0005887 - integral component of plasma membrane
GO:0051119 - sugar transmembrane transporter activity
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA