Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : Q9LH79

dbSWEET id: dbswt_650

Accession:   Q9LH79

Uniprot status:   Reviewed

Organism:   Arabidopsis thaliana

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Camelineae ⇒ Arabidopsis.

Sequence Information back to top


Sequence length:   236

Substrate Binding Site:   CNFN           CVV:   413       CHI:   -1.7

Selectivity Filter:   LNMM           CVV:   468       CHI:   4.1

Fasta sequence:

>sp|Q9LH79|SWET2_ARATH|Reviewed|Arabidopsis_thaliana|236
MDVFAFNASLSMCKDVAGIAGNIFAFGLFVSPMPTFRRIMRNKSTEQFSGLPYIYALLNC
LICLWYGTPFISHSNAMLMTVNSVGATFQLCYIILFIMHTDKKNKMKMLGLLFVVFAVVG
VIVAGSLQIPDQLTRWYFVGFLSCGSLVSMFASPLFVINLVIRTKSVEFMPFYLSLSTFL
MSASFLLYGLFNSDAFVYTPNGIGTILGIVQLALYCYYHRNSIEEETKEPLIVSYV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   7     Model end:   220

Alignment file: Q9LH79.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  Q9LH79_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.1% favored    5.9% allowed    .5% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  Q9LH79_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.6% favored    5.3% allowed    .5% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  Q9LH79_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.5% favored    6.4% allowed    1.6% week    .5% disallowed

Gene Informationback to top


Gene ID:   820705     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0005887 - integral component of plasma membrane

GO:0051119 - sugar transmembrane transporter activity

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur