Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : Q9FY94

dbSWEET id: dbswt_90

Accession:   Q9FY94

Uniprot status:   Reviewed

Organism:   Arabidopsis thaliana

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Camelineae ⇒ Arabidopsis.

Sequence Information back to top


Sequence length:   292

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>sp|Q9FY94|SWT15_ARATH|Reviewed|Arabidopsis_thaliana|292
MGVMINHHFLAFIFGILGNVISFLVFLAPVPTFYRIYKRKSTESFQSLPYQVSLFSCMLW
LYYALIKKDAFLLITINSFGCVVETLYIAMFFAYATREKRISAMKLFIAMNVAFFSLILM
VTHFVVKTPPLQVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEYMPFTLSFFLTISAV
MWFAYGLFLNDICIAIPNVVGFVLGLLQMVLYLVYRNSNEKPEKINSSEQQLKSIVVMSP
LGVSEVHPVVTESVDPLSEAVHHEDLSKVTKVEEPSIENGKCYVEATRPETV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   4     Model end:   217

Alignment file: Q9FY94.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  Q9FY94_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.9% favored    5.6% allowed    .5% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  Q9FY94_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.4% favored    4.6% allowed    1.5% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  Q9FY94_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.3% favored    5.6% allowed    1.5% week    .5% disallowed

Gene Informationback to top


Gene ID:   831156     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0000139 - Golgi membrane

GO:0005887 - integral component of plasma membrane

GO:0008515 - sucrose transmembrane transporter activity

GO:0051119 - sugar transmembrane transporter activity

GO:0071215 - cellular response to abscisic acid stimulus

GO:0071470 - cellular response to osmotic stress

GO:0071446 - cellular response to salicylic acid stimulus

GO:0009793 - embryo development ending in seed dormancy

GO:0010150 - leaf senescence

GO:0010431 - seed maturation

GO:0015770 - sucrose transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur