| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : Q9FPN0
dbSWEET id: dbswt_266
Accession: Q9FPN0
Uniprot status: Reviewed
Organism: Petunia hybrida
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Solanales ⇒ Solanaceae ⇒ Petunioideae ⇒ Petunia.
Sequence Information back to top
Sequence length: 265
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVC CVV: 369 CHI: 10.1
Fasta sequence:
>sp|Q9FPN0|NEC1_PETHY|Reviewed|Petunia_hybrida|265
MAQLRADDLSFIFGLLGNIVSFMVFLAPVPTFYKIYKRKSSEGYQAIPYMVALFSAGLLL
YYAYLRKNAYLIVSINGFGCAIELTYISLFLFYAPRKSKIFTGWLMLLELGALGMVMPIT
YLLAEGSHRVMIVGWICAAINVAVFAAPLSIMRQVIKTKSVEFMPFTLSLFLTLCATMWF
FYGFFKKDFYIAFPNILGFLFGIVQMLLYFVYKDSKRIDDEKSDPVREATKSKEGVEIII
NIEDDNSDNALQSMEKDFSRLRTSK
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 3 Model end: 214
Alignment file: Q9FPN0.pir
Inward Open:
Template: 5CTG.pdb
Model structure: Q9FPN0_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.6% favored 5.3% allowed .5% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: Q9FPN0_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.6% favored 5.3% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: Q9FPN0_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.6% favored 5.3% allowed 1.1% week .0% disallowed
Gene Ontologyback to top
GO:0005887 - integral component of plasma membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0009901 - anther dehiscence
GO:0009555 - pollen development
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF22