Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : Q9CHT9

dbSWEET id: dbswt_1892

Accession:   Q9CHT9

Uniprot status:   Unreviewed

Organism:   Lactococcus lactis

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Lactococcus.

Sequence Information back to top


Sequence length:   86

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|Q9CHT9|Q9CHT9_LACLA|Unreviewed|Lactococcus lactis|86
MNQEKFIKYLSWVATGMSVMMYVSYLPQIANNLSGMKGNPIQPLVAAINCTLWVTYGIGK
KPRDLALATANFPGIIFGLVTFFTAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   11     Model end:   87

Inward Open:

Template:   4X5M.pdb

Model structure:  Q9CHT9_inward.pdb    Alignment file: Q9CHT9_inw.pir

Procheck score ⇒ Ramachandran plot: 87.1% favored    8.9% allowed    3.2% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  Q9CHT9_outward.pdb    Alignment file: Q9CHT9_out.pir

Procheck score ⇒ Ramachandran plot: 91.1% favored    8.1% allowed    .8% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  Q9CHT9_occluded.pdb    Alignment file: Q9CHT9_occ.pir

Procheck score ⇒ Ramachandran plot: 87.1% favored    11.3% allowed    .8% week    .8% disallowed

Gene Informationback to top


Gene ID:   1114249

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur