Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : Q9BRV3

dbSWEET id: dbswt_984

Accession:   Q9BRV3

Uniprot status:   Reviewed

Organism:   Homo sapiens

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Craniata ⇒ Vertebrata ⇒ Euteleostomi ⇒ Mammalia ⇒ Eutheria ⇒ Euarchontoglires ⇒ Primates ⇒ Haplorrhini ⇒ Catarrhini ⇒ Hominidae ⇒ Homo.

Sequence Information back to top


Sequence length:   221

Substrate Binding Site:   NNWN           CVV:   451       CHI:   -11.4

Selectivity Filter:   MNMT           CVV:   437       CHI:   -0.4

Fasta sequence:

>sp|Q9BRV3|SWET1_HUMAN|Reviewed|Homo_sapiens|221
MEAGGFLDSLIYGACVVFTLGMFSAGLSDLRHMRMTRSVDNVQFLPFLTTEVNNLGWLSY
GALKGDGILIVVNTVGAALQTLYILAYLHYCPRKRVVLLQTATLLGVLLLGYGYFWLLVP
NPEARLQQLGLFCSVFTISMYLSPLADLAKVIQTKSTQCLSYPLTIATLLTSASWCLYGF
RLRDPYIMVSNFPGIVTSFIRFWLFWKYPQEQDRNYWLLQT

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   2     Model end:   210

Alignment file: Q9BRV3.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  Q9BRV3_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.2% favored    6.6% allowed    2.2% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  Q9BRV3_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.9% favored    5.5% allowed    1.6% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  Q9BRV3_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.9% favored    6.0% allowed    1.1% week    .0% disallowed

Gene Informationback to top


Gene ID:   55974     Total Exons:   5     Coding Exons:   5

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0012505 - endomembrane system

GO:0005794 - Golgi apparatus

GO:0000139 - Golgi membrane

GO:0016021 - integral component of membrane

GO:0005634 - nucleus

GO:0005886 - plasma membrane

GO:0042947 - glucoside transmembrane transporter activity

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

GO:0045815 - positive regulation of gene expression epigenetic

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur