| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : Q95KW8
dbSWEET id: dbswt_983
Accession: Q95KW8
Uniprot status: Reviewed
Organism: Papio anubis
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Craniata ⇒ Vertebrata ⇒ Euteleostomi ⇒ Mammalia ⇒ Eutheria ⇒ Euarchontoglires ⇒ Primates ⇒ Haplorrhini ⇒ Catarrhini ⇒ Cercopithecidae ⇒ Cercopithecinae ⇒ Papio.
Sequence Information back to top
Sequence length: 221
Substrate Binding Site: NNWN CVV: 451 CHI: -11.4
Selectivity Filter: MNMT CVV: 437 CHI: -0.4
Fasta sequence:
>sp|Q95KW8|SWET1_PAPAN|Reviewed|Papio_anubis|221
MEAGGFLDSLIYGACVVFTLGMFSAGLSDLRHMRMTRSVDNVQFLPFLTTEVNNLGWLSY
GALKGDRILIVVNTVGAALQTLYILAYLHYCPRKRVVLLQTATLLGVLLLGYGYFWLLVP
NPEARLQLLGLFCSVFTISMYLSPLADLAKVIQTKSTQCLSYPLTIATVLTSASWCLYGF
RLRVPYIMVSNFPGIVTSFIRFWLFWKYPQEQDRNYWFLQT
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 2 Model end: 210
Alignment file: Q95KW8.pir
Inward Open:
Template: 5CTG.pdb
Model structure: Q95KW8_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.4% favored 4.9% allowed 1.1% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: Q95KW8_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.8% favored 7.1% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: Q95KW8_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.3% favored 6.6% allowed 1.1% week 1.1% disallowed
Gene Informationback to top
Gene ID: 100126708 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0012505 - endomembrane system
GO:0000139 - Golgi membrane
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0051119 - sugar transmembrane transporter activity
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA