| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : Q8LBF7
dbSWEET id: dbswt_782
Accession: Q8LBF7
Uniprot status: Reviewed
Organism: Arabidopsis thaliana
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Camelineae ⇒ Arabidopsis.
Sequence Information back to top
Sequence length: 258
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMN CVV: 440 CHI: -1.3
Fasta sequence:
>sp|Q8LBF7|SWET7_ARATH|Reviewed|Arabidopsis_thaliana|258
MVFAHLNLLRKIVGIIGNFIALCLFLSPTPTFVRIVKKKSVEEYSPIPYLATLINCLVWV
LYGLPTVHPDSTLVITINGTGILIEIVFLTIFFVYCGRQKQRLIISAVIAAETAFIAILA
VLVLTLQHTTEKRTMSVGIVCCVFNVMMYASPLSVMKMVIKTKSVEFMPFWLSVAGFLNA
GVWTIYALMPFDPFMAIPNGIGCLFGLAQLILYGAYYKSTKRIMAERENQPGYVGLSSAI
ARTGSEKTANTNQEPNNV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 3 Model end: 218
Alignment file: Q8LBF7.pir
Inward Open:
Template: 5CTG.pdb
Model structure: Q8LBF7_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.7% favored 3.2% allowed 1.1% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: Q8LBF7_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.5% favored 7.4% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: Q8LBF7_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.1% favored 5.3% allowed 1.1% week .5% disallowed
Gene Informationback to top
Gene ID: 826682 Total Exons: 5 Coding Exons: 5
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number





Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005887 - integral component of plasma membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA