| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : Q8F4F7
dbSWEET id: dbswt_1890
Accession: Q8F4F7
Uniprot status: Unreviewed
Organism: Leptospira interrogans
Kingdom: Bacteria
Sequence Information back to top
Sequence length: 96
Substrate Binding Site: VNVN CVV: 402 CHI: 1.4
Selectivity Filter: SGSG CVV: 242 CHI: -2.4
Fasta sequence:
>tr|Q8F4F7|Q8F4F7_LEPIN|Unreviewed|Leptospira interrogans|96
MDSITFLGYIASLLTTISFLPQLIRILMGGSTKDISRNMYIVLVTGVFLWFIYGCLKQDF
PIILANAFTFLFAATILYFKLKSDSKVKLKNKSNEE
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 5 Model end: 82 Inward Open: Template: 4X5M.pdb Model structure: Q8F4F7_inward.pdb Alignment file: Q8F4F7_inw.pir Procheck score ⇒ Ramachandran plot: 95.6% favored 2.9% allowed 1.5% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: Q8F4F7_outward.pdb Alignment file: Q8F4F7_out.pir Procheck score ⇒ Ramachandran plot: 96.3% favored 3.7% allowed .0% week .0% disallowed Occluded: Model structure: Q8F4F7_occluded.pdb Alignment file: Q8F4F7_occ.pir Procheck score ⇒ Ramachandran plot: 97.1% favored 2.9% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA