Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : Q84WN3

dbSWEET id: dbswt_514

Accession:   Q84WN3

Uniprot status:   Reviewed

Organism:   Arabidopsis thaliana

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Camelineae ⇒ Arabidopsis.

Sequence Information back to top


Sequence length:   241

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   VGMN           CVV:   373       CHI:   2.2

Fasta sequence:

>sp|Q84WN3|SWT17_ARATH|Reviewed|Arabidopsis_thaliana|241
MAEASFYIGVIGNVISVLVFLSPVETFWKIVKRRSTEEYKSLPYICTLLGSSLWTYYGIV
TPGEYLVSTVNGFGALVETIYVSLFLFYAPRHLKLKTVDVDAMLNVFFPIAAIVATRSAF
EDEKMRSQSIGFISAGLNIIMYGSPLSAMKTVVTTKSVKYMPFWLSFFLFLNGAIWAVYA
LLQHDVFLLVPNGVGFVFGTMQLILYGIYRNAKPVGLSNGLSEIAQDEEEGLTSRVEPLL
S

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   211

Alignment file: Q84WN3.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  Q84WN3_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.0% favored    4.9% allowed    1.6% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  Q84WN3_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.0% favored    5.9% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  Q84WN3_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.4% favored    4.9% allowed    2.2% week    .5% disallowed

Gene Informationback to top


Gene ID:   827274     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0009705 - plant-type vacuole membrane

GO:0005353 - fructose transmembrane transporter activity

GO:0051119 - sugar transmembrane transporter activity

GO:0070417 - cellular response to cold

GO:0006995 - cellular response to nitrogen starvation

GO:0007623 - circadian rhythm

GO:1902334 - fructose export from vacuole to cytoplasm

GO:0015755 - fructose transport

GO:0051260 - protein homooligomerization

GO:0009646 - response to absence of light

GO:0009750 - response to fructose

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur