Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : Q7Q9H3
dbSWEET id: dbswt_1225
Accession: Q7Q9H3
Uniprot status: Unreviewed
Organism: Anopheles gambiae
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Nematocera ⇒ Culicoidea ⇒ Culicidae ⇒ Anophelinae ⇒ Anopheles.
Sequence Information back to top
Sequence length: 229
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: QSFV CVV: 427 CHI: 2.7
Fasta sequence:
>tr|Q7Q9H3|Q7Q9H3_ANOGA|Unreviewed|Anopheles_gambiae|229
MDGIMSKGSLASLATVATVLQFLTGTVICNRYIRKKSTGDTSAFPFISGFLSCFMWLKYG
VLTEESTLILVNFIGSALFFSYTVVFFIFCVNKREVIRQMMVISCIILSATLYTLFETDD
EKSIRVIGLLCCCLAVLFFASPLTMLAHVIRTQNTDSLPFPIIMASFFVCLLWTAYGVLI
GDRFIQIPNLLGGILAGIQLTLYVIYPKKKASFSGGPRYSPLVSENPIL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 208
Alignment file: Q7Q9H3.pir
Inward Open:
Template: 5CTG.pdb
Model structure: Q7Q9H3_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.5% favored 7.0% allowed .0% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: Q7Q9H3_outward.pdb
Procheck score ⇒ Ramachandran plot: 90.4% favored 8.0% allowed .5% week 1.1% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: Q7Q9H3_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.0% favored 7.5% allowed .0% week .5% disallowed
Gene Informationback to top
Gene ID: 1274944 Total Exons: 6 Coding Exons: 5
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA