Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : Q7Q5N8

dbSWEET id: dbswt_1224

Accession:   Q7Q5N8

Uniprot status:   Unreviewed

Organism:   Anopheles gambiae

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Nematocera ⇒ Culicoidea ⇒ Culicidae ⇒ Anophelinae ⇒ Anopheles.

Sequence Information back to top


Sequence length:   228

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   QFLV           CVV:   478       CHI:   7.3

Fasta sequence:

>tr|Q7Q5N8|Q7Q5N8_ANOGA|Unreviewed|Anopheles_gambiae|228
MESIAVALQPYKDTVGLTAAIVTVVQFFSGVLALNAIRRQGNTRGFSALPFLGGTVFCLL
NIQFGQMLRDDGMIRVNFIGLALNLLYVCGFYLYTEGPAKTAVWGQIGLAGALTAGVLSY
VQYEDPQLVEFRFGLILTGLLWTLVGMPLLGLGDILKKKSTEGLPFPIIFLGAVVSFAWL
LYGIILRSNFLVVQNLMALALSAVQLSLFIIFPSGAAKPPPTPAKKRN

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   214

Alignment file: Q7Q5N8.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  Q7Q5N8_inward.pdb

Procheck score ⇒ Ramachandran plot: 90.4% favored    7.3% allowed    1.1% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  Q7Q5N8_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.5% favored    7.3% allowed    .6% week    .6% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  Q7Q5N8_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.1% favored    4.5% allowed    2.3% week    1.1% disallowed

Gene Informationback to top


Gene ID:   1276949     Total Exons:   3     Coding Exons:   3

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF5

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur