Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : Q74IV1
dbSWEET id: dbswt_1886
Accession: Q74IV1
Uniprot status: Unreviewed
Organism: Lactobacillus johnsonii
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 93
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|Q74IV1|Q74IV1_LACJO|Unreviewed|Lactobacillus johnsonii|93
MKKKIRSFDNKTVLTIGRIGSVLSVLMYVSYIPQIMNNLQGNYGNPIQPLVAAINCLIWV
LYALLREKKDWPLFVANFPGILFGLATFITSLH
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 17 Model end: 93 Inward Open: Template: 4X5M.pdb Model structure: Q74IV1_inward.pdb Alignment file: Q74IV1_inw.pir Procheck score ⇒ Ramachandran plot: 90.6% favored 7.0% allowed 2.3% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: Q74IV1_outward.pdb Alignment file: Q74IV1_out.pir Procheck score ⇒ Ramachandran plot: 89.1% favored 9.4% allowed 1.6% week .0% disallowed Occluded: Model structure: Q74IV1_occluded.pdb Alignment file: Q74IV1_occ.pir Procheck score ⇒ Ramachandran plot: 92.2% favored 6.2% allowed 1.6% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA