Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : Q701Y2

dbSWEET id: dbswt_2082

Accession:   Q701Y2

Uniprot status:   Unreviewed

Organism:   uncultured crenarchaeote

Kingdom:   Archaea

Taxonomy back to top


Archaea ⇒ Crenarchaeota ⇒ environmental samples.

Sequence Information back to top


Sequence length:   89

Substrate Binding Site:   LNLN           CVV:   440       CHI:   0.6

Selectivity Filter:   SGSG           CVV:   242       CHI:   -2.4

Fasta sequence:

>tr|Q701Y2|Q701Y2_9CREN|Unreviewed|uncultured crenarchaeote|89
MTEYVIFLIGISATVFSLWSTVPQISKSLKTKKTDDVSKWLIISLIVGLSLWVIYGIMKG
DIVIASANAIGVTLNLILFGLKIKYTVQK

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   7     Model end:   84

Inward Open:

Template:   4X5M.pdb

Model structure:  Q701Y2_inward.pdb    Alignment file: Q701Y2_inw.pir

Procheck score ⇒ Ramachandran plot: 95.6% favored    2.9% allowed    .7% week    .7% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  Q701Y2_outward.pdb    Alignment file: Q701Y2_out.pir

Procheck score ⇒ Ramachandran plot: 96.3% favored    2.9% allowed    .7% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  Q701Y2_occluded.pdb    Alignment file: Q701Y2_occ.pir

Procheck score ⇒ Ramachandran plot: 94.1% favored    5.9% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur