Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : Q6FFR8

dbSWEET id: dbswt_1884

Accession:   Q6FFR8

Uniprot status:   Unreviewed

Organism:   Acinetobacter baylyi

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Gammaproteobacteria ⇒ Pseudomonadales ⇒ Moraxellaceae ⇒ Acinetobacter.

Sequence Information back to top


Sequence length:   87

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|Q6FFR8|Q6FFR8_ACIAD|Unreviewed|Acinetobacter baylyi|87
MIKKNDERFIQILGWVATFTAIGMYVSYIPQIMNNLAGTKGNPIQPFVAAINCLLWVLYG
LKRKDYPLAAANAPGILFGAAAFFTSL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   14     Model end:   88

Inward Open:

Template:   4X5M.pdb

Model structure:  Q6FFR8_inward.pdb    Alignment file: Q6FFR8_inw.pir

Procheck score ⇒ Ramachandran plot: 92.6% favored    5.7% allowed    .8% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  Q6FFR8_outward.pdb    Alignment file: Q6FFR8_out.pir

Procheck score ⇒ Ramachandran plot: 93.4% favored    4.9% allowed    .8% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  Q6FFR8_occluded.pdb    Alignment file: Q6FFR8_occ.pir

Procheck score ⇒ Ramachandran plot: 95.9% favored    4.1% allowed    .0% week    .0% disallowed

Gene Informationback to top


Gene ID:   25685608

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur