Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : Q5QHN7

dbSWEET id: dbswt_1223

Accession:   Q5QHN7

Uniprot status:   Unreviewed

Organism:   Branchiostoma belcheri

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Cephalochordata ⇒ Branchiostomidae ⇒ Branchiostoma.

Sequence Information back to top


Sequence length:   210

Substrate Binding Site:   NNWN           CVV:   451       CHI:   -11.4

Selectivity Filter:   MNMA           CVV:   411       CHI:   2.1

Fasta sequence:

>tr|Q5QHN7|Q5QHN7_BRABE|Unreviewed|Branchiostoma_belcheri|210
MEEIEVVSTVCLVFTLCMFSAGIPDCWKMWRTRSTQNVPFLPLLVTCINNLIWLYYGLWR
QDSTLIIVNAVGALLQSVCMFTYMVASKQKSRPLSQIFVGVVLLTTLYLYLTIVITSHTV
LVDRLGLAGAGITILMYTSPMIELVTVIRTKSTRSISRPLTVATFFASSLWFYYGYLLRD
PYVQVPNLPGIISSIVRLFLFWKYPGEKLA

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   206

Alignment file: Q5QHN7.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  Q5QHN7_inward.pdb

Procheck score ⇒ Ramachandran plot: 89.7% favored    8.1% allowed    .0% week    2.2% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  Q5QHN7_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.0% favored    4.9% allowed    2.2% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  Q5QHN7_occluded.pdb

Procheck score ⇒ Ramachandran plot: 89.7% favored    9.2% allowed    1.1% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur