| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : Q5QHN7
dbSWEET id: dbswt_1223
Accession: Q5QHN7
Uniprot status: Unreviewed
Organism: Branchiostoma belcheri
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Cephalochordata ⇒ Branchiostomidae ⇒ Branchiostoma.
Sequence Information back to top
Sequence length: 210
Substrate Binding Site: NNWN CVV: 451 CHI: -11.4
Selectivity Filter: MNMA CVV: 411 CHI: 2.1
Fasta sequence:
>tr|Q5QHN7|Q5QHN7_BRABE|Unreviewed|Branchiostoma_belcheri|210
MEEIEVVSTVCLVFTLCMFSAGIPDCWKMWRTRSTQNVPFLPLLVTCINNLIWLYYGLWR
QDSTLIIVNAVGALLQSVCMFTYMVASKQKSRPLSQIFVGVVLLTTLYLYLTIVITSHTV
LVDRLGLAGAGITILMYTSPMIELVTVIRTKSTRSISRPLTVATFFASSLWFYYGYLLRD
PYVQVPNLPGIISSIVRLFLFWKYPGEKLA
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 206
Alignment file: Q5QHN7.pir
Inward Open:
Template: 5CTG.pdb
Model structure: Q5QHN7_inward.pdb
Procheck score ⇒ Ramachandran plot: 89.7% favored 8.1% allowed .0% week 2.2% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: Q5QHN7_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.0% favored 4.9% allowed 2.2% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: Q5QHN7_occluded.pdb
Procheck score ⇒ Ramachandran plot: 89.7% favored 9.2% allowed 1.1% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA