Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : Q5NAZ9

dbSWEET id: dbswt_539

Accession:   Q5NAZ9

Uniprot status:   Reviewed

Organism:   Oryza sativa

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Oryzoideae ⇒ Oryzeae ⇒ Oryzinae ⇒ Oryza.

Sequence Information back to top


Sequence length:   252

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   LNMS           CVV:   417       CHI:   1.4

Fasta sequence:

>sp|Q5NAZ9|SWT3B_ORYSJ|Reviewed|Oryza_sativa|252
MVSNTIRVAVGILGNAASMLLYAAPILTFRRVIKKGSVEEFSCVPYILALFNCLLYTWYG
LPVVSSGWENSTVSSINGLGILLEIAFISIYTWFAPRERKKFVLRMVLPVLAFFALTAIF
SSFLFHTHGLRKVFVGSIGLVASISMYSSPMVAAKQVITTKSVEFMPFYLSLFSFLSSAL
WMIYGLLGKDLFIASPNFIGCPMGILQLVLYCIYRKSHKEAEKLHDIDQENGLKVVTTHE
KITGREPEAQRD

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   216

Alignment file: Q5NAZ9.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  Q5NAZ9_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.1% favored    6.8% allowed    .5% week    1.6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  Q5NAZ9_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.6% favored    5.8% allowed    1.1% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  Q5NAZ9_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.1% favored    6.8% allowed    .0% week    1.1% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005887 - integral component of plasma membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur