Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : Q5EB14

dbSWEET id: dbswt_981

Accession:   Q5EB14

Uniprot status:   Reviewed

Organism:   Danio rerio

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Craniata ⇒ Vertebrata ⇒ Euteleostomi ⇒ Actinopterygii ⇒ Neopterygii ⇒ Teleostei ⇒ Ostariophysi ⇒ Cypriniformes ⇒ Cyprinidae ⇒ Danio.

Sequence Information back to top


Sequence length:   219

Substrate Binding Site:   NNWN           CVV:   451       CHI:   -11.4

Selectivity Filter:   MNMT           CVV:   437       CHI:   -0.4

Fasta sequence:

>sp|Q5EB14|SWET1_DANRE|Reviewed|Danio_rerio|219
MDFLQLLSCACIIFTVGMFTTGLTDLKKMKATQSADNVQFLPFLTTCLNNLGWLYYGLLK
GDGTVIFVNIIGAFLQTVYIATYCHYTKEKRRVYTQTLLMVSVLCVAWVYFSLVISPGEA
QLSQLGLTCSVFTISMYLSPLADLLDIMRTKSVERLSFSLTVATFFTSTSWTLYGLQLGD
YYIMVPNTPGIFTSLIRFFLFWWFGAVIPQIPSYKLIQI

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   2     Model end:   206

Alignment file: Q5EB14.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  Q5EB14_inward.pdb

Procheck score ⇒ Ramachandran plot: 90.8% favored    5.4% allowed    2.2% week    1.6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  Q5EB14_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.0% favored    6.5% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  Q5EB14_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.0% favored    5.4% allowed    1.6% week    .0% disallowed

Gene Informationback to top


Gene ID:   503533     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0000139 - Golgi membrane

GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur