Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : Q5EB14
dbSWEET id: dbswt_981
Accession: Q5EB14
Uniprot status: Reviewed
Organism: Danio rerio
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Craniata ⇒ Vertebrata ⇒ Euteleostomi ⇒ Actinopterygii ⇒ Neopterygii ⇒ Teleostei ⇒ Ostariophysi ⇒ Cypriniformes ⇒ Cyprinidae ⇒ Danio.
Sequence Information back to top
Sequence length: 219
Substrate Binding Site: NNWN CVV: 451 CHI: -11.4
Selectivity Filter: MNMT CVV: 437 CHI: -0.4
Fasta sequence:
>sp|Q5EB14|SWET1_DANRE|Reviewed|Danio_rerio|219
MDFLQLLSCACIIFTVGMFTTGLTDLKKMKATQSADNVQFLPFLTTCLNNLGWLYYGLLK
GDGTVIFVNIIGAFLQTVYIATYCHYTKEKRRVYTQTLLMVSVLCVAWVYFSLVISPGEA
QLSQLGLTCSVFTISMYLSPLADLLDIMRTKSVERLSFSLTVATFFTSTSWTLYGLQLGD
YYIMVPNTPGIFTSLIRFFLFWWFGAVIPQIPSYKLIQI
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 2 Model end: 206
Alignment file: Q5EB14.pir
Inward Open:
Template: 5CTG.pdb
Model structure: Q5EB14_inward.pdb
Procheck score ⇒ Ramachandran plot: 90.8% favored 5.4% allowed 2.2% week 1.6% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: Q5EB14_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.0% favored 6.5% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: Q5EB14_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.0% favored 5.4% allowed 1.6% week .0% disallowed
Gene Informationback to top
Gene ID: 503533 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0000139 - Golgi membrane
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA