Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : Q39VX0

dbSWEET id: dbswt_1882

Accession:   Q39VX0

Uniprot status:   Unreviewed

Organism:   Geobacter metallireducens

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Deltaproteobacteria ⇒ Desulfuromonadales ⇒ Geobacteraceae ⇒ Geobacter.

Sequence Information back to top


Sequence length:   105

Substrate Binding Site:   MNMN           CVV:   440       CHI:   -3.2

Selectivity Filter:   AGAG           CVV:   230       CHI:   2.8

Fasta sequence:

>tr|Q39VX0|Q39VX0_GEOMG|Unreviewed|Geobacter metallireducens| 105
MNGEIMLGLVAGAVTSIAVVPQVARAYRTKRVRDISVWQPVILVAGMILWLTYGVMIGDI
PLIAANIFSIACNGILIGMKFCYRGGDNGADGGYSLGQTNQTEDL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   82

Inward Open:

Template:   4X5M.pdb

Model structure:  Q39VX0_inward.pdb    Alignment file: Q39VX0_inw.pir

Procheck score ⇒ Ramachandran plot: 95.4% favored    4.6% allowed    .0% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  Q39VX0_outward.pdb    Alignment file: Q39VX0_out.pir

Procheck score ⇒ Ramachandran plot: 94.6% favored    4.6% allowed    .8% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  Q39VX0_occluded.pdb    Alignment file: Q39VX0_occ.pir

Procheck score ⇒ Ramachandran plot: 98.5% favored    1.5% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur