Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : Q2M1B6
dbSWEET id: dbswt_1222
Accession: Q2M1B6
Uniprot status: Unreviewed
Organism: Drosophila pseudoobscura
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Brachycera ⇒ Muscomorpha ⇒ Ephydroidea ⇒ Drosophilidae ⇒ Drosophila ⇒ Sophophora.
Sequence Information back to top
Sequence length: 231
Substrate Binding Site: TNWN CVV: 448 CHI: -8.6
Selectivity Filter: QLLV CVV: 467 CHI: 8.3
Fasta sequence:
>tr|Q2M1B6|Q2M1B6_DROPS|Unreviewed|Drosophila_pseudoobscura|231
MEALGDLLAPHSELIAKVAGTITTLQFLSGIALLNDIRKKGSSDVYPVGPFLGGVVLTVL
SLKLANIMNDAAMINTNLIGLVINFVFLGGFYYYASSGSRGNIWKQIGYASIFLLACTAY
ANFEDPKKIEFRLGMLITGILVWLVGSPLLHLPKIIAKKSTEGMPFPIILSGNLVATSWM
LYAISIKNTVMVLQNLLLLILGGIQLSMFAIYPNKPAAKKPAAKKDSKKEK
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 5 Model end: 214
Alignment file: Q2M1B6.pir
Inward Open:
Template: 5CTG.pdb
Model structure: Q2M1B6_inward.pdb
Procheck score ⇒ Ramachandran plot: 87.2% favored 8.3% allowed 2.2% week 2.2% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: Q2M1B6_outward.pdb
Procheck score ⇒ Ramachandran plot: 89.4% favored 9.4% allowed .6% week .6% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: Q2M1B6_occluded.pdb
Procheck score ⇒ Ramachandran plot: 88.9% favored 9.4% allowed 1.1% week .6% disallowed
Gene Informationback to top
Gene ID: 4812831 Total Exons: 3 Coding Exons: 3
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF5