Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : Q290X1

dbSWEET id: dbswt_979

Accession:   Q290X1

Uniprot status:   Reviewed

Organism:   Drosophila pseudoobscura

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Brachycera ⇒ Muscomorpha ⇒ Ephydroidea ⇒ Drosophilidae ⇒ Drosophila ⇒ Sophophora.

Sequence Information back to top


Sequence length:   226

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   QSFV           CVV:   427       CHI:   2.7

Fasta sequence:

>sp|Q290X1|SWET1_DROPS|Reviewed|Drosophila_pseudoobscura|226
MSAVAYELLSTTAVISTVFQFLSGAMICRKYIQKKSTGDSSGVPFICGFLSCSFWLRYGV
LTEEQSIVLVNIIGSTLFLIYTLIYYVFTVNKRAFVRQFAFVLAVLIAVVVVYTNRLADQ
RDEMIRITGIFCCIVTVCFFAAPLATLLHVIRAKNSESLPLPLIATSFLVSLQWLIYGIL
ISDSFIQIPNFLGCLLSMLQLSLFVVYPPRSYSGQGYKLVEQAVPF

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   209

Alignment file: Q290X1.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  Q290X1_inward.pdb

Procheck score ⇒ Ramachandran plot: 92.2% favored    4.7% allowed    2.6% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  Q290X1_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.8% favored    5.7% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  Q290X1_occluded.pdb

Procheck score ⇒ Ramachandran plot: 90.6% favored    7.3% allowed    1.6% week    .5% disallowed

Gene Informationback to top


Gene ID:   4804038     Total Exons:   5     Coding Exons:   5

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0000139 - Golgi membrane

GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0007431 - salivary gland development

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur