Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : Q290X1
dbSWEET id: dbswt_979
Accession: Q290X1
Uniprot status: Reviewed
Organism: Drosophila pseudoobscura
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Brachycera ⇒ Muscomorpha ⇒ Ephydroidea ⇒ Drosophilidae ⇒ Drosophila ⇒ Sophophora.
Sequence Information back to top
Sequence length: 226
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: QSFV CVV: 427 CHI: 2.7
Fasta sequence:
>sp|Q290X1|SWET1_DROPS|Reviewed|Drosophila_pseudoobscura|226
MSAVAYELLSTTAVISTVFQFLSGAMICRKYIQKKSTGDSSGVPFICGFLSCSFWLRYGV
LTEEQSIVLVNIIGSTLFLIYTLIYYVFTVNKRAFVRQFAFVLAVLIAVVVVYTNRLADQ
RDEMIRITGIFCCIVTVCFFAAPLATLLHVIRAKNSESLPLPLIATSFLVSLQWLIYGIL
ISDSFIQIPNFLGCLLSMLQLSLFVVYPPRSYSGQGYKLVEQAVPF
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 209
Alignment file: Q290X1.pir
Inward Open:
Template: 5CTG.pdb
Model structure: Q290X1_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.2% favored 4.7% allowed 2.6% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: Q290X1_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.8% favored 5.7% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: Q290X1_occluded.pdb
Procheck score ⇒ Ramachandran plot: 90.6% favored 7.3% allowed 1.6% week .5% disallowed
Gene Informationback to top
Gene ID: 4804038 Total Exons: 5 Coding Exons: 5
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0000139 - Golgi membrane
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0007431 - salivary gland development
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA