Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : Q21254
dbSWEET id: dbswt_1221
Accession: Q21254
Uniprot status: Unreviewed
Organism: Caenorhabditis elegans
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Rhabditoidea ⇒ Rhabditidae ⇒ Peloderinae ⇒ Caenorhabditis.
Sequence Information back to top
Sequence length: 239
Substrate Binding Site: SQAN CVV: 377 CHI: -3.8
Selectivity Filter: LGGM CVV: 344 CHI: 4.9
Fasta sequence:
>tr|Q21254|Q21254_CAEEL|Unreviewed|Caenorhabditis_elegans|239
MEIDLGTVSASRLFAMYTSNLVWSLFLTSTALHAVALITSPVQAVHKWVRRQSSDSDTPI
PYICAVIGSALWLRYSIFLRDTKLILLQTYAVSMQLFFVIALIFYRTKRRKLIRLMTGIA
AALSLLFLYIGNMNDEDGKEFTGRIASGAQIAGSLVCPYLIYKAVTSKCIDFVPLAPVVF
TWVMELHAIVYSIGIDDFYMLLANVIFFCMDGSLLSMFFVYPTEKKKKNLKSSPIPTVM
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 16 Model end: 223
Alignment file: Q21254.pir
Inward Open:
Template: 5CTG.pdb
Model structure: Q21254_inward.pdb
Procheck score ⇒ Ramachandran plot: 88.4% favored 9.5% allowed 2.1% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: Q21254_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.1% favored 8.4% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: Q21254_occluded.pdb
Procheck score ⇒ Ramachandran plot: 86.8% favored 11.6% allowed .5% week 1.1% disallowed
Gene Informationback to top
Gene ID: 187047 Total Exons: 7 Coding Exons: 7
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA