Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : Q21254

dbSWEET id: dbswt_1221

Accession:   Q21254

Uniprot status:   Unreviewed

Organism:   Caenorhabditis elegans

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Rhabditoidea ⇒ Rhabditidae ⇒ Peloderinae ⇒ Caenorhabditis.

Sequence Information back to top


Sequence length:   239

Substrate Binding Site:   SQAN           CVV:   377       CHI:   -3.8

Selectivity Filter:   LGGM           CVV:   344       CHI:   4.9

Fasta sequence:

>tr|Q21254|Q21254_CAEEL|Unreviewed|Caenorhabditis_elegans|239
MEIDLGTVSASRLFAMYTSNLVWSLFLTSTALHAVALITSPVQAVHKWVRRQSSDSDTPI
PYICAVIGSALWLRYSIFLRDTKLILLQTYAVSMQLFFVIALIFYRTKRRKLIRLMTGIA
AALSLLFLYIGNMNDEDGKEFTGRIASGAQIAGSLVCPYLIYKAVTSKCIDFVPLAPVVF
TWVMELHAIVYSIGIDDFYMLLANVIFFCMDGSLLSMFFVYPTEKKKKNLKSSPIPTVM

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   16     Model end:   223

Alignment file: Q21254.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  Q21254_inward.pdb

Procheck score ⇒ Ramachandran plot: 88.4% favored    9.5% allowed    2.1% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  Q21254_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.1% favored    8.4% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  Q21254_occluded.pdb

Procheck score ⇒ Ramachandran plot: 86.8% favored    11.6% allowed    .5% week    1.1% disallowed

Gene Informationback to top


Gene ID:   187047     Total Exons:   7     Coding Exons:   7

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur