Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : Q1RK22

dbSWEET id: dbswt_1881

Accession:   Q1RK22

Uniprot status:   Unreviewed

Organism:   Rickettsia bellii

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Alphaproteobacteria ⇒ Rickettsiales ⇒ Rickettsiaceae ⇒ Rickettsieae ⇒ Rickettsia ⇒ belli group.

Sequence Information back to top


Sequence length:   89

Substrate Binding Site:   LNLN           CVV:   440       CHI:   0.6

Selectivity Filter:   QAQA           CVV:   362       CHI:   -3.4

Fasta sequence:

>tr|Q1RK22|Q1RK22_RICBR|Unreviewed|Rickettsia bellii|89
MSPKFMKFYEKYMTVVGTVGNFMFYVQAHKIFTCKSAASVSLPAFTISAVALSSWLLYGI
LIKNTPIIIANIVGFIGALLVLVAIILHT

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   13     Model end:   87

Inward Open:

Template:   4X5M.pdb

Model structure:  Q1RK22_inward.pdb    Alignment file: Q1RK22_inw.pir

Procheck score ⇒ Ramachandran plot: 89.2% favored    9.2% allowed    .8% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  Q1RK22_outward.pdb    Alignment file: Q1RK22_out.pir

Procheck score ⇒ Ramachandran plot: 92.3% favored    5.4% allowed    2.3% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  Q1RK22_occluded.pdb    Alignment file: Q1RK22_occ.pir

Procheck score ⇒ Ramachandran plot: 91.5% favored    5.4% allowed    2.3% week    .8% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur