| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : Q19VE6
dbSWEET id: dbswt_67
Accession: Q19VE6
Uniprot status: Reviewed
Organism: Oryza sativa
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Oryzoideae ⇒ Oryzeae ⇒ Oryzinae ⇒ Oryza.
Sequence Information back to top
Sequence length: 307
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>sp|Q19VE6|SWT11_ORYSI|Reviewed|Oryza_sativa|307
MAGGFLSMANPAVTLSGVAGNIISFLVFLAPVATFLQVYKKKSTGGYSSVPYVVALFSSV
LWIFYALVKTNSRPLLTINAFGCGVEAAYIVLYLVYAPRRARLRTLAFFLLLDVAAFALI
VVTTLYLVPKPHQVKFLGSVCLAFSMAVFVAPLSIIFKVIKTKSVEFMPIGLSVCLTLSA
VAWFCYGLFTKDPYVMYPNVGGFFFSCVQMGLYFWYRKPRNTAVLPTTSDSMSPISAAAA
ATQRVIELPAGTHAFTILSVSPIPILGVHKVEVVAAEQAADGVAAAAAADKELLQNKPEV
IEITAAV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 6 Model end: 218
Alignment file: Q19VE6.pir
Inward Open:
Template: 5CTG.pdb
Model structure: Q19VE6_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.5% favored 5.9% allowed 1.6% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: Q19VE6_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.0% favored 5.3% allowed 1.6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: Q19VE6_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.0% favored 6.4% allowed .5% week .0% disallowed
Gene Ontologyback to top
GO:0005887 - integral component of plasma membrane
GO:0005886 - plasma membrane
GO:0008515 - sucrose transmembrane transporter activity
GO:0051119 - sugar transmembrane transporter activity
GO:0006825 - copper ion transport
GO:0042742 - defense response to bacterium
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA